the number of occurences of each character of one string,in another
6 views (last 30 days)
Show older comments
i have a string of more than 100 characters (fasta format of a protein sequence. like
'MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSEDPSIH'
which is being shortened here for simplicity) and i want to find out whether or not it is hydrophobic. so i have to check the number of occurrences of each of the characters in the set 'A C F I L M P V W Y'(hydrophob amino acids) in my fasta string. considering the very long length of fasta strings, is there any easy way to do that by matlab string functions?
0 Comments
Accepted Answer
Azzi Abdelmalek
on 28 Dec 2014
Edited: Azzi Abdelmalek
on 28 Dec 2014
str='MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSEDPSIH'
p={'A' 'C' 'F' 'I' 'L' 'M' 'P' 'V' 'W' 'Y'}'
out=[p cellfun(@(x) nnz(ismember(str,x)),p,'un',0)]
More Answers (4)
Peter Perkins
on 29 Dec 2014
Another possibility:
>> s = 'MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSEDPSIH';
>> t = 'ACFILMPVWY';
>> n = hist(double(s),1:90);
>> n(t)
ans =
6 2 4 6 13 2 7 7 1 7
1 Comment
Luuk van Oosten
on 24 Jan 2015
Edited: Luuk van Oosten
on 24 Jan 2015
I reckon you are using the BioInformatics Toolbox. In that case you can probably use:
aacount('SEQ')
Where SEQ is of course your sequence of interest: MEQNGLDHDSRSSIDTTINDTQKTFLEF....
and using
nr_A = All.A
nr_C = All.C
nr_F = All.F
etc. (you get the idea)
you get the numbers of your hydrophobic residues. Sum these and you have your hydrophobic score. You might want to 'normalize' this number by dividing this number by the total amount of amino acids in the sequence.
Of course you can write a loop for this and calculate the hydrophobic score for all your sequences in your FASTA file.
0 Comments
Shoaibur Rahman
on 28 Dec 2014
s = 'MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVPTLSEDPSIH';
numA = sum(s=='A')
numC = sum(s=='C')
numF = sum(s=='F')
numI = sum(s=='I')
numL = sum(s=='L')
numM = sum(s=='M')
numP = sum(s=='P')
numV = sum(s=='V')
numW = sum(s=='W')
numY = sum(s=='Y')
See Also
Categories
Find more on Genomics and Next Generation Sequencing in Help Center and File Exchange
Community Treasure Hunt
Find the treasures in MATLAB Central and discover how the community can help you!
Start Hunting!